Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SAT polyclonal antibody (A01)

  • Catalog # : H00006303-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SAT.
  • Immunogen:
  • SAT (NP_002961, 88 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006303-A01
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in MCF-7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SAT polyclonal antibody (A01), Lot # 051213JC01. Western Blot analysis of SAT expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6303
  • Gene Name:
  • SAT1
  • Gene Alias:
  • DC21,KFSD,SAT,SSAT,SSAT-1
  • Gene Description:
  • spermidine/spermine N1-acetyltransferase 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the intracellular concentration of polyamines and their transport out of cells. Defects in this gene are associated with keratosis follicularis spinulosa decalvans (KFSD). Alternatively spliced transcripts have been found for this gene
  • Other Designations:
  • OTTHUMP00000023061,diamine acetyltransferase 1,spermidine/spermine N1-acetyltransferase,spermidine/spermine N1-acetyltransferase alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook