SAG purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SAG expression in transfected 293T cell line (H00006295-T01) by SAG MaxPab polyclonal antibody.
Lane 1: SAG transfected lysate(44.55 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SAG protein.
Immunogen
SAG (AAI56657.1, 1 a.a. ~ 405 a.a) full-length human protein.
Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SAG expression in transfected 293T cell line (H00006295-T01) by SAG MaxPab polyclonal antibody.
Lane 1: SAG transfected lysate(44.55 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SAG
Entrez GeneID
6295GeneBank Accession#
BC156656.1Protein Accession#
AAI56657.1Gene Name
SAG
Gene Alias
DKFZp686D1084, DKFZp686I1383, S-AG
Gene Description
S-antigen; retina and pineal gland (arrestin)
Gene Ontology
HyperlinkGene Summary
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. S-arrestin, also known as S-antigen, is a major soluble photoreceptor protein that is involved in desensitization of the photoactivated transduction cascade. It is expressed in the retina and the pineal gland and inhibits coupling of rhodopsin to transducin in vitro. Additionally, S-arrestin is highly antigenic, and is capable of inducing experimental autoimmune uveoretinitis. Mutations in this gene have been associated with Oguchi disease, a rare autosomal recessive form of night blindness. [provided by RefSeq
Other Designations
S-arrestin|arrestin 1|retinal S-antigen (48 KDa protein)|rod photoreceptor arrestin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com