SAA4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SAA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of SAA4 expression in transfected 293T cell line (H00006291-T02) by SAA4 MaxPab polyclonal antibody.
Lane 1: SAA4 transfected lysate(14.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SAA4 protein.
Immunogen
SAA4 (NP_006503.1, 1 a.a. ~ 130 a.a) full-length human protein.
Sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SAA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of SAA4 expression in transfected 293T cell line (H00006291-T02) by SAA4 MaxPab polyclonal antibody.
Lane 1: SAA4 transfected lysate(14.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SAA4
Entrez GeneID
6291GeneBank Accession#
NM_006512.1Protein Accession#
NP_006503.1Gene Name
SAA4
Gene Alias
C-SAA, CSAA
Gene Description
serum amyloid A4, constitutive
Omim ID
104752Gene Ontology
HyperlinkGene Summary
O
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Association of urinary ketamine and APOA1 levels with bladder dysfunction in ketamine abusers revealed via proteomics and targeted metabolite analyses.
Jo-Chuan Liu, Yi-Ting Chen, Ya-Ju Hsieh, Chia-Chun Wu, Ming-Chyi Huang, Yu-Chao Hsu, Chun-Te Wu, Chih-Ken Chen, Srinivas Dash, Jau-Song Yu.
Scientific Reports 2021 May; 11(1):9583.
Application：WB, Human, Human urine samples.
-
Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
Chen CL, Lin TS, Tsai CH, Wu CC, Chung T, Chien KY, Wu M, Chang YS, Yu JS, Chen YT.
Journal of Proteomics 2013 Jun; 85:28.
Application：WB, Human, Human urine samples.
-
Association of urinary ketamine and APOA1 levels with bladder dysfunction in ketamine abusers revealed via proteomics and targeted metabolite analyses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com