S100B monoclonal antibody (M52), clone 2A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant S100B.
Immunogen
S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — S100B
Entrez GeneID
6285GeneBank Accession#
NM_006272.1Protein Accession#
NP_006263.1Gene Name
S100B
Gene Alias
NEF, S100, S100beta
Gene Description
S100 calcium binding protein B
Omim ID
176990Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq
Other Designations
OTTHUMP00000174958|S-100 calcium-binding protein, beta chain|S100 beta|S100 calcium binding protein, beta (neural)|S100 calcium-binding protein, beta|S100 calcium-binding protein, beta (neural)
-
Interactome
-
Disease
-
Publication Reference
-
Magnetic bead-quantum dot assay for detection of a biomarker for traumatic brain injury.
Kim C, Searson PC.
Nanoscale 2015 Nov; 7(42):17820.
Application:Func, Human, Serum.
-
Magnetic bead-quantum dot assay for detection of a biomarker for traumatic brain injury.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com