S100A10 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A10 full-length ORF ( AAH15973, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A10
Entrez GeneID
6281GeneBank Accession#
BC015973Protein Accession#
AAH15973Gene Name
S100A10
Gene Alias
42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10
Gene Description
S100 calcium binding protein A10
Omim ID
114085Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq
Other Designations
OTTHUMP00000015269|OTTHUMP00000015270|S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|annexin II ligand, calpactin I, lig
-
Interactome
-
Disease
-
Publication Reference
-
Prevalence of anti-S100A10 antibodies in antiphospholipid syndrome patients.
Salle V, Sagnier A, Diouf M, Schmidt J, Smail A, Galmiche A, Herpe YE, Duhaut P.
Thrombosis Research 2019 Jul; 179:15.
Application:ELISA, N/A, Recombinant protein.
-
Chemotactic Activity of S100A7 (Psoriasin) Is Mediated by the Receptor for Advanced Glycation End Products and Potentiates Inflammation with Highly Homologous but Functionally Distinct S100A15.
Wolf R, Howard OM, Dong HF, Voscopoulos C, Boeshans K, Winston J, Divi R, Gunsior M, Goldsmith P, Ahvazi B, Chavakis T, Oppenheim JJ, Yuspa SH.
Journal of Immunology 2008 Jul; 181(2):1499.
-
Factor Xa binding to annexin 2 mediates signal transduction via protease-activated receptor 1.
Bhattacharjee G, Ahamed J, Pawlinski R, Liu C, Mackman N, Ruf W, Edgington TS.
Circulation Research 2008 Jan; 102(4):457.
Application:PI, Human, HUVEC.
-
Prevalence of anti-S100A10 antibodies in antiphospholipid syndrome patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com