S100A10 monoclonal antibody (M09), clone 3E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant S100A10.
Immunogen
S100A10 (AAH15973, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
S100A10 monoclonal antibody (M09), clone 3E10. Western Blot analysis of S100A10 expression in HeLa(Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A10 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A10 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — S100A10
Entrez GeneID
6281GeneBank Accession#
BC015973Protein Accession#
AAH15973Gene Name
S100A10
Gene Alias
42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10
Gene Description
S100 calcium binding protein A10
Omim ID
114085Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq
Other Designations
OTTHUMP00000015269|OTTHUMP00000015270|S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|annexin II ligand, calpactin I, lig
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com