S100A6 monoclonal antibody (M10), clone 6B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
S100A6 monoclonal antibody (M10), clone 6B5 Western Blot analysis of S100A6 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M10), clone 6B5.
Lane 1: S100A6 transfected lysate(10.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A6 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant S100A6.
Immunogen
S100A6 (AAH01431, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
S100A6 monoclonal antibody (M10), clone 6B5 Western Blot analysis of S100A6 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M10), clone 6B5.
Lane 1: S100A6 transfected lysate(10.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — S100A6
Entrez GeneID
6277GeneBank Accession#
BC001431Protein Accession#
AAH01431Gene Name
S100A6
Gene Alias
2A9, 5B10, CABP, CACY, PRA
Gene Description
S100 calcium binding protein A6
Omim ID
114110Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq
Other Designations
OTTHUMP00000015472|OTTHUMP00000015473|S100 calcium-binding protein A6|S100 calcium-binding protein A6 (calcyclin)|calcyclin|prolactin receptor-associated protein
-
Interactome
-
Disease
-
Publication Reference
-
Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells.
Chen Y, Huang K, Nakatsu MN, Xue Z, Deng SX, Fan G.
Human Molecular Genetics 2012 Dec; 22(7):1271.
Application：IF, Human, Adult and fetal cornea tissues.
-
S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
Li J, Riau AK, Setiawan M, Mehta JS, Ti SE, Tong L, Tan DT, Beuerman RW.
Molecular Vision 2011 Aug; 17:2263.
Application：IF, Human, Corneal-limbal epithelial cells, Ocular surface squamous cell carcinoma tissues.
-
Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com