S100A4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A4 full-length ORF ( AAH16300, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.85
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A4
Entrez GeneID
6275GeneBank Accession#
BC016300Protein Accession#
AAH16300Gene Name
S100A4
Gene Alias
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Gene Description
S100 calcium binding protein A4
Omim ID
114210Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000015467|OTTHUMP00000015468|OTTHUMP00000015469|OTTHUMP00000032895|S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|S100 calcium-binding protein A4|S100 calcium-binding protein A4 (calcium prote
-
Interactome
-
Disease
-
Publication Reference
-
Overexpression of S100A4 in human cancer cell lines resistant to methotrexate.
Mencia N, Selga E, Rico I, de Almagro MC, Villalobos X, Ramirez S, Adan J, Hernandez JL, Noe V, Ciudad CJ.
BMC Cancer 2010 Jun; 10:250.
Application：WB-Re, As a marker.
-
Relaxin Enhances S100A4 and Promotes Growth of Human Thyroid Carcinoma Cell Xenografts.
Radestock Y, Willing C, Kehlen A, Hoang-Vu C, Hombach-Klonisch S.
Molecular Cancer Research 2010 Apr; 8(4):494.
Application：Func, Human, FTC133 cells, HUVECs.
-
Overexpression of S100A4 in human cancer cell lines resistant to methotrexate.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com