S100A4 monoclonal antibody (M01J), clone 1F12-1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
S100A4 monoclonal antibody (M01J), clone 1F12-1G7. Western Blot analysis of S100A4 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody (M01J), clone 1F12-1G7.
Lane 1: S100A4 transfected lysate (Predicted MW: 11.22 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A4 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A4 on HeLa cell . [antibody concentration 15 ug/ml]
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant S100A4.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Host
Mouse
Reactivity
Human, Mouse
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
S100A4 monoclonal antibody (M01J), clone 1F12-1G7. Western Blot analysis of S100A4 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody (M01J), clone 1F12-1G7.
Lane 1: S100A4 transfected lysate (Predicted MW: 11.22 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A4 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to S100A4 on HeLa cell . [antibody concentration 15 ug/ml] -
Gene Info — S100A4
Entrez GeneID
6275GeneBank Accession#
BC016300Protein Accession#
AAH16300Gene Name
S100A4
Gene Alias
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Gene Description
S100 calcium binding protein A4
Omim ID
114210Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000015467|OTTHUMP00000015468|OTTHUMP00000015469|OTTHUMP00000032895|S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|S100 calcium-binding protein A4|S100 calcium-binding protein A4 (calcium prote
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com