S100A4 purified MaxPab mouse polyclonal antibody (B03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of S100A4 expression in transfected 293T cell line (H00006275-T05) by S100A4 MaxPab polyclonal antibody.
Lane 1: S100A4 transfected lysate(11.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100A4 protein.
Immunogen
S100A4 (NP_002952.1, 1 a.a. ~ 101 a.a) full-length human protein.
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100A4 expression in transfected 293T cell line (H00006275-T05) by S100A4 MaxPab polyclonal antibody.
Lane 1: S100A4 transfected lysate(11.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — S100A4
Entrez GeneID
6275GeneBank Accession#
NM_002961.2Protein Accession#
NP_002952.1Gene Name
S100A4
Gene Alias
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Gene Description
S100 calcium binding protein A4
Omim ID
114210Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000015467|OTTHUMP00000015468|OTTHUMP00000015469|OTTHUMP00000032895|S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|S100 calcium-binding protein A4|S100 calcium-binding protein A4 (calcium prote
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com