S100A4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.22 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant S100A4.
Immunogen
S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag.
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.22 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — S100A4
Entrez GeneID
6275GeneBank Accession#
BC016300Protein Accession#
AAH16300Gene Name
S100A4
Gene Alias
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Gene Description
S100 calcium binding protein A4
Omim ID
114210Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000015467|OTTHUMP00000015468|OTTHUMP00000015469|OTTHUMP00000032895|S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|S100 calcium-binding protein A4|S100 calcium-binding protein A4 (calcium prote
-
Interactome
-
Disease
-
Publication Reference
-
CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway.
Chen PS, Wang MY, Wu SN, Su JL, Hong CC, Chuang SE, Chen MW, Hua KT, Wu YL, Cha ST, Babu MS, Chen CN, Lee PH, Chang KJ, Kuo ML.
Journal of Cell Science 2007 Jun; 120(Pt 12):2053.
Application：WB, Human, MCF-7, MDA-MB-231 cells.
-
CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com