S100A3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.22 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant S100A3.
Immunogen
S100A3 (NP_002951, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Sequence
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.22 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — S100A3
Entrez GeneID
6274GeneBank Accession#
NM_002960Protein Accession#
NP_002951Gene Name
S100A3
Gene Alias
S100E
Gene Description
S100 calcium binding protein A3
Omim ID
176992Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq
Other Designations
OTTHUMP00000015474|OTTHUMP00000032963|S100 calcium-binding protein A3
-
Interactome
-
Disease
-
Publication Reference
-
The Vitamin D Receptor Is a Wnt Effector that Controls Hair Follicle Differentiation and Specifies Tumor Type in Adult Epidermis.
Palmer HG, Anjos-Afonso F, Carmeliet G, Takeda H, Watt FM.
PLoS ONE 2008 Jan; 3(1):e1483.
Application：IF, Mouse, Hair follicles.
-
The Vitamin D Receptor Is a Wnt Effector that Controls Hair Follicle Differentiation and Specifies Tumor Type in Adult Epidermis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com