S100A2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of S100A2 expression in transfected 293T cell line (H00006273-T01) by S100A2 MaxPab polyclonal antibody.
Lane1:S100A2 transfected lysate(10.78 KDa).
Lane 2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100A2 protein.
Immunogen
S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length human protein.
Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100A2 expression in transfected 293T cell line (H00006273-T01) by S100A2 MaxPab polyclonal antibody.
Lane1:S100A2 transfected lysate(10.78 KDa).
Lane 2:Non-transfected lysate.
-
Gene Info — S100A2
Entrez GeneID
6273GeneBank Accession#
BC002829Protein Accession#
AAH02829Gene Name
S100A2
Gene Alias
CAN19, MGC111539, S100L
Gene Description
S100 calcium binding protein A2
Omim ID
176993Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. [provided by RefSeq
Other Designations
OTTHUMP00000032968|OTTHUMP00000032969|S100 calcium-binding protein A2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com