S100A1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A1 full-length ORF ( AAH14392, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A1
Entrez GeneID
6271GeneBank Accession#
BC014392Protein Accession#
AAH14392Gene Name
S100A1
Gene Alias
S100, S100-alpha, S100A
Gene Description
S100 calcium binding protein A1
Omim ID
176940Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. [provided by RefSeq
Other Designations
OTTHUMP00000035100|S100 alpha|S100 calcium-binding protein A1|S100 protein, alpha polypeptide
-
Interactome
-
Disease
-
Publication Reference
-
Dorsal root ganglia in Friedreich ataxia: satellite cell proliferation and inflammation.
Koeppen AH, Ramirez RL, Becker AB, Mazurkiewicz JE.
Acta Neuropathologica Communications 2016 May; 4(1):46.
Application：IHC-P, Human, Dorsal root ganglia.
-
Dorsal root ganglia in Friedreich ataxia: satellite cell proliferation and inflammation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com