Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S100A1 (Human) Recombinant Protein (P01)

  • Catalog # : H00006271-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human S100A1 full-length ORF ( AAH14392, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006271-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6271
  • Gene Name:
  • S100A1
  • Gene Alias:
  • S100,S100-alpha,S100A
  • Gene Description:
  • S100 calcium binding protein A1
  • Gene Summary:
  • The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035100,S100 alpha,S100 calcium-binding protein A1,S100 protein, alpha polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook