S100A1 monoclonal antibody (M01), clone 1D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant S100A1.
Immunogen
S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100A1 expression in transfected 293T cell line by S100A1 monoclonal antibody (M01), clone 1D5.
Lane 1: S100A1 transfected lysate(10.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S100A1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — S100A1
Entrez GeneID
6271GeneBank Accession#
NM_006271Protein Accession#
NP_006262Gene Name
S100A1
Gene Alias
S100, S100-alpha, S100A
Gene Description
S100 calcium binding protein A1
Omim ID
176940Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. [provided by RefSeq
Other Designations
OTTHUMP00000035100|S100 alpha|S100 calcium-binding protein A1|S100 protein, alpha polypeptide
-
Interactome
-
Disease
-
Publication Reference
-
TFE3 and TFEB-rearranged renal cell carcinomas: an immunohistochemical panel to differentiate from common renal cell neoplasms.
Anna Caliò, Stefano Marletta, Matteo Brunelli, Serena Pedron, Sofia Canete Portillo, Diego Segala, Elena Bariani, Stefano Gobbo, George Netto, Guido Martignoni.
Virchows Archiv : an International Journal of Pathology 2022 Dec; 481(6):877.
Application:IHC-P, Human, Human renal cell carcinomas.
-
Comprehensive analysis of 34 MiT family translocation renal cell carcinomas and review of the literature: investigating prognostic markers and therapy targets.
Caliò A, Brunelli M, Segala D, Pedron S, Remo A, Ammendola S, Munari E, Pierconti F, Mosca A, Bollito E, Sidoni A, Fisogni S, Sacco C, Canu L, Sentinelli S, Fraccon AP, Fiorentino M, Scott C, Milella M, Porta C, Argani P, Martignoni G.
Pathology 2020 Feb; 52(3):297.
Application:IHC, Human, t(6;11), Xp11 cells.
-
FISH Scoring on Paraffin Sections Versus Single-cell Suspension for Chromophobe Renal Carcinoma and Renal Oncocytoma.
Brunelli M, Segala D, Delahunt B, Parolini C, Bersani S, Cheng L, Eble JN, Chilosi M, Gobbo S, Martignoni G.
Anticancer Research 2011 Oct; 31(10):3137.
Application:IHC-P, Human, Human renal cell carcinomas.
-
TFE3 and TFEB-rearranged renal cell carcinomas: an immunohistochemical panel to differentiate from common renal cell neoplasms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com