Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RSU1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006251-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RSU1 partial ORF ( NP_036557.1, 178 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006251-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6251
  • Gene Name:
  • RSU1
  • Gene Alias:
  • FLJ31034,RSP-1
  • Gene Description:
  • Ras suppressor protein 1
  • Gene Summary:
  • This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019216,OTTHUMP00000019217,OTTHUMP00000019218,ras suppressor protein 1,ras suppressor protein 1 variant 1,ras suppressor protein 1 variant 2,ras suppressor protein 1 variant 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook