RRM1 monoclonal antibody (M08), clone 2D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RRM1.
Immunogen
RRM1 (NP_001024.1, 593 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RRM1 monoclonal antibody (M08), clone 2D11. Western Blot analysis of RRM1 expression in K-562.Western Blot (Cell lysate)
RRM1 monoclonal antibody (M08), clone 2D11. Western Blot analysis of RRM1 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M08), clone 2D11.
Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RRM1
Entrez GeneID
6240GeneBank Accession#
NM_001033.2Protein Accession#
NP_001024.1Gene Name
RRM1
Gene Alias
R1, RIR1, RR1
Gene Description
ribonucleotide reductase M1
Omim ID
180410Gene Ontology
HyperlinkGene Summary
This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq
Other Designations
ribonucleoside-diphosphate reductase M1 chain|ribonucleotide reductase M1 polypeptide|ribonucleotide reductase, R1 subunit|ribonucleotide reductase, large subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com