RRM1 monoclonal antibody (M07), clone 2G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M07), clone 2G6.
Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (47.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RRM1.
Immunogen
RRM1 (NP_001024.1, 593 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M07), clone 2G6.
Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RRM1
Entrez GeneID
6240GeneBank Accession#
NM_001033.2Protein Accession#
NP_001024.1Gene Name
RRM1
Gene Alias
R1, RIR1, RR1
Gene Description
ribonucleotide reductase M1
Omim ID
180410Gene Ontology
HyperlinkGene Summary
This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq
Other Designations
ribonucleoside-diphosphate reductase M1 chain|ribonucleotide reductase M1 polypeptide|ribonucleotide reductase, R1 subunit|ribonucleotide reductase, large subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com