RRAS monoclonal antibody (M01), clone 2E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RRAS.
Immunogen
RRAS (AAH16286, 109 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RRAS monoclonal antibody (M01), clone 2E12 Western Blot analysis of RRAS expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of RRAS transfected lysate using anti-RRAS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRAS MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRAS is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RRAS
-
Interactome
-
Pathway
-
Publication Reference
-
R-Ras subfamily proteins elicit distinct physiologic effects and phosphoproteome alterations in neurofibromin-null MPNST cells.
Shannon M Weber, Nicole M Brossier, Amanda Prechtl, Stephen Barnes, Landon S Wilson, Stephanie N Brosius, Jody Fromm Longo, Steven L Carroll.
Cell Communication and Signaling 2021 Sep; 19(1):95.
Application:WB-Ce, WB-Tr, Human, 90-8, ST88-14, NMS2, NMS2-PC, S462, STS-26T, T265-2c, YST-1 cells.
-
R-Ras Deficiency in Pericytes Causes Frequent Microphthalmia and Perturbs Retinal Vascular Development.
Jose Luis Herrera and Masanobu Komatsu.
Journal of Vascular Research 2021 Apr; 58(4):252.
Application:IF, Mouse, Mouse retina.
-
High endothelial venules accelerate naive T cell recruitment by tumor necrosis factor-mediated R-Ras up-regulation.
Junko Sawada, Carole Y Perrot, Linyuan Chen, Ashley E Fournier-Goss, Jeremiah Oyer, Alicja Copik, Masanobu Komatsu.
The American Journal of Pathology 2021 Feb; 191(2):396.
Application:IF, IHC-Fr, Human, Mouse , HUVECs, Mouse lymph nodes.
-
Prolonged activation of cAMP signaling leads to endothelial barrier disruption via transcriptional repression of RRAS.
Perrot CY, Sawada J, Komatsu M.
FASEB Journal 2018 May; [Epub].
Application:IS, WB, WB-Tr, Human, HUVECs, HDMECs, HUVEC-siCtrl, HUVEC-siCREB1, HUVEC-siATF2, HUVEC-siCREB3, HUVEC-siPKACα cells, Breast cancer.
-
R-Ras subfamily proteins elicit distinct physiologic effects and phosphoproteome alterations in neurofibromin-null MPNST cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com