RPS23 monoclonal antibody (M02), clone 1E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3. Western Blot analysis of RPS23 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3 Western Blot analysis of RPS23 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3. Western Blot analysis of RPS23 expression in PC-12(Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS23 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS23 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS23.
Immunogen
RPS23 (NP_001016, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3. Western Blot analysis of RPS23 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3 Western Blot analysis of RPS23 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RPS23 monoclonal antibody (M02), clone 1E3. Western Blot analysis of RPS23 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS23 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS23 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPS23
Entrez GeneID
6228GeneBank Accession#
NM_001025Protein Accession#
NP_001016Gene Name
RPS23
Gene Alias
FLJ35016
Gene Description
ribosomal protein S23
Omim ID
603683Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S23|homolog of yeast ribosomal protein S28
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com