RPS17 polyclonal antibody (A03)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RPS17.
Immunogen
RPS17 (NP_001012, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Sequence
EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS17 polyclonal antibody (A03), Lot # 060529JCS1. Western Blot analysis of RPS17 expression in NIH/3T3.Western Blot (Cell lysate)
RPS17 polyclonal antibody (A03), Lot # 060529JCS1 Western Blot analysis of RPS17 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
RPS17 polyclonal antibody (A03), Lot # 060529JCS1. Western Blot analysis of RPS17 expression in Raw 264.7.Western Blot (Cell lysate)
RPS17 polyclonal antibody (A03), Lot # 060529JCS1. Western Blot analysis of RPS17 expression in PC-12.Western Blot (Recombinant protein)
ELISA
-
Gene Info — RPS17
Entrez GeneID
6218GeneBank Accession#
NM_001021Protein Accession#
NP_001012Gene Name
RPS17
Gene Alias
DBA4, MGC72007, RPS17L1, RPS17L2
Gene Description
ribosomal protein S17
Omim ID
180472Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S17E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S17
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com