RPS7 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in Raw 264.7.
Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in PC-12.
Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of RPS7 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in NIH/3T3.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RPS7.
Immunogen
RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
Sequence
IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in Raw 264.7.Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in PC-12.Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of RPS7 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
RPS7 polyclonal antibody (A01). Western Blot analysis of RPS7 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — RPS7
Entrez GeneID
6201GeneBank Accession#
NM_001011Protein Accession#
NP_001002Gene Name
RPS7
Gene Alias
-
Gene Description
ribosomal protein S7
Omim ID
603658Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S7
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com