Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS6KB2 monoclonal antibody (M08), clone 4B11

  • Catalog # : H00006199-M08
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RPS6KB2.
  • Immunogen:
  • RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006199-M08
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RPS6KB2 expression in transfected 293T cell line by RPS6KB2 monoclonal antibody (M08), clone 4B11.

    Lane 1: RPS6KB2 transfected lysate(53.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged RPS6KB2 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6199
  • Gene Name:
  • RPS6KB2
  • Gene Alias:
  • KLS,P70-beta,P70-beta-1,P70-beta-2,S6K-beta2,S6K2,SRK,STK14B,p70(S6K)-beta,p70S6Kb
  • Gene Description:
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • Gene Summary:
  • This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq
  • Other Designations:
  • S6 kinase-related kinase,p70 ribosomal S6 kinase beta,ribosomal protein S6 kinase, 70kD, polypeptide 2,serine/threonine-protein kinase 14 beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook