Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS6KB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006198-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RPS6KB1 partial ORF ( NP_003152, 416 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006198-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6198
  • Gene Name:
  • RPS6KB1
  • Gene Alias:
  • PS6K,S6K,S6K1,STK14A,p70(S6K)-alpha,p70-S6K,p70-alpha
  • Gene Description:
  • ribosomal protein S6 kinase, 70kDa, polypeptide 1
  • Gene Summary:
  • This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq
  • Other Designations:
  • p70 S6 kinase, alpha 1,p70 S6 kinase, alpha 2,ribosomal protein S6 kinase, 70kD, polypeptide 1,serine/threonine kinase 14 alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook