RPS6KA2 monoclonal antibody (M01), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPS6KA2 monoclonal antibody (M01), clone 1F6 Western Blot analysis of RPS6KA2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody (M01), clone 1F6.
Lane 1: RPS6KA2 transfected lysate(83.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
RNAi Knockdown (Antibody validated)
Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi ( Cat # H00006196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody (M01) clone 1F6 (Cat # H00006196-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RPS6KA2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS6KA2.
Immunogen
RPS6KA2 (AAH02363, 631 a.a. ~ 733 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS6KA2 monoclonal antibody (M01), clone 1F6 Western Blot analysis of RPS6KA2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody (M01), clone 1F6.
Lane 1: RPS6KA2 transfected lysate(83.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi ( Cat # H00006196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody (M01) clone 1F6 (Cat # H00006196-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RPS6KA2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPS6KA2
Entrez GeneID
6196GeneBank Accession#
BC002363Protein Accession#
AAH02363Gene Name
RPS6KA2
Gene Alias
HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, pp90RSK3
Gene Description
ribosomal protein S6 kinase, 90kDa, polypeptide 2
Omim ID
601685Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
ribosomal S6 kinase 3|ribosomal protein S6 kinase alpha 2|ribosomal protein S6 kinase, 90kD, polypeptide 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
p90 ribosomal S6 kinase 3 contributes to cardiac insufficiency in α-tropomyosin Glu180Gly transgenic mice.
Passariello CL, Gayanilo M, Kritzer MD, Thakur H, Cozacov Z, Rusconi F, Wieczorek D, Sanders M, Li J, Kapiloff MS.
American Journal of Physiology. Heart and Circulatory Physiology 2013 Oct; 305(7):H1010.
Application：WB-Ti, Mouse, Heart.
-
p90 ribosomal S6 kinase 3 contributes to cardiac insufficiency in α-tropomyosin Glu180Gly transgenic mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com