Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS6KA2 monoclonal antibody (M01), clone 1F6

  • Catalog # : H00006196-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RPS6KA2.
  • Immunogen:
  • RPS6KA2 (AAH02363, 631 a.a. ~ 733 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006196-M01
    Western Blot detection against Immunogen (37.07 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RPS6KA2 monoclonal antibody (M01), clone 1F6 Western Blot analysis of RPS6KA2 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody (M01), clone 1F6.

    Lane 1: RPS6KA2 transfected lysate(83.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi ( Cat # H00006196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RPS6KA2 monoclonal antibody (M01) clone 1F6 (Cat # H00006196-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RPS6KA2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6196
  • Gene Name:
  • RPS6KA2
  • Gene Alias:
  • HU-2,MAPKAPK1C,RSK,RSK3,S6K-alpha,S6K-alpha2,p90-RSK3,pp90RSK3
  • Gene Description:
  • ribosomal protein S6 kinase, 90kDa, polypeptide 2
  • Gene Summary:
  • This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • ribosomal S6 kinase 3,ribosomal protein S6 kinase alpha 2,ribosomal protein S6 kinase, 90kD, polypeptide 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook