RPS2 monoclonal antibody (M01), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RPS2 monoclonal antibody (M01), clone 3G6. Western Blot analysis of RPS2 expression in human liver.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS2 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS2.
Immunogen
RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RPS2 monoclonal antibody (M01), clone 3G6. Western Blot analysis of RPS2 expression in human liver.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPS2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPS2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RPS2
Entrez GeneID
6187GeneBank Accession#
NM_002952Protein Accession#
NP_002943Gene Name
RPS2
Gene Alias
LLREP3, MGC102851, MGC117344, MGC117345
Gene Description
ribosomal protein S2
Omim ID
603624Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S2|OK/KNS-cl.6
-
Interactome
-
Pathway
-
Publication Reference
-
The rRNA m6A methyltransferase METTL5 is involved in pluripotency and developmental programs.
Ignatova VV, Stolz P, Kaiser S, Gustafsson TH, Lastres PR, Sanz-Moreno A, Cho YL, Amarie OV, Aguilar-Pimentel A, Klein-Rodewald T, Calzada-Wack J, Becker L, Marschall S, Kraiger M, Garrett L, Seisenberger C, Hölter SM, Borland K, Van De Logt E, Jansen PWTC, Baltissen MP, Valenta M, Vermeulen M, Wurst W, Gailus-Durner V, Fuchs H, de Angelis MH, Rando OJ, Kellner SM, Bultmann S, Schneider R.
Genes & Development 2020 May; 34(9-10):715.
Application：WB-Ce, Mouse, Embryonic stem cells.
-
PRMT3 is essential for dendritic spine maturation in rat hippocampal neurons.
Miyata S, Mori Y, Tohyama M.
Brain Research 2010 Sep; 1352:11.
Application：WB, Rat, Rat hippocampal neurons.
-
The rRNA m6A methyltransferase METTL5 is involved in pluripotency and developmental programs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com