RPS2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RPS2.
Immunogen
RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag.
Sequence
APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.67 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RPS2
Entrez GeneID
6187GeneBank Accession#
NM_002952Protein Accession#
NP_002943Gene Name
RPS2
Gene Alias
LLREP3, MGC102851, MGC117344, MGC117345
Gene Description
ribosomal protein S2
Omim ID
603624Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S2|OK/KNS-cl.6
-
Interactome
-
Pathway
-
Publication Reference
-
Differential expression of novel tyrosine kinase substrates during breast cancer development.
Chen Y, Choong LY, Lin Q, Philp R, Wong CH, Ang BK, Tan YL, Loh MC, Hew CL, Shah N, Druker BJ, Chong PK, Lim YP.
Molecular & Cellular Proteomics 2007 Sep; 6(12):2072.
Application:IP-WB, Human, HEK 293T cells.
-
Differential expression of novel tyrosine kinase substrates during breast cancer development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com