RPL19 monoclonal antibody (M01), clone 3H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4 Western Blot analysis of RPL19 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.
Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1 ~ 10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL19 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPL19.
Immunogen
RPL19 (NP_000972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4 Western Blot analysis of RPL19 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.
Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1 ~ 10 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL19 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPL19
Entrez GeneID
6143GeneBank Accession#
NM_000981Protein Accession#
NP_000972Gene Name
RPL19
Gene Alias
DKFZp779D216, FLJ27452, MGC71997
Gene Description
ribosomal protein L19
Omim ID
180466Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L19E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L19|ribosomal protein L19, cytosolic, N-terminus truncated
-
Interactome
-
Pathway
-
Publication Reference
-
Disruption of valosin-containing protein activity causes cardiomyopathy and reveals pleiotropic functions in cardiac homeostasis.
Brody MJ, Vanhoutte D, Bakshi CV, Liu R, Correll RN, Sargent MA, Molkentin JD.
The Journal of Biological Chemistry 2019 May; 294(22):8918.
Application：IHC-Fr, Mouse, Mouse hearts.
-
Inhibition of autophagy, lysosome and VCP function impairs stress granule assembly.
Seguin SJ, Morelli FF, Vinet J, Amore D, De Biasi S, Poletti A, Rubinsztein DC, Carra S.
Cell Death and Differentiation 2014 Dec; 21(12):1838.
Application：IF, WB-Tr, Human, Mouse, HeLa cells, MEFs.
-
Substitution p.A350V in Na⁺/Mg²⁺ exchanger SLC41A1, potentially associated with Parkinson's disease, is a gain-of-function mutation.
Kolisek M, Sponder G, Mastrototaro L, Smorodchenko A, Launay P, Vormann J, Schweigel-Röntgen M.
PLoS One 2013 Aug; 8(8):e71096.
Application：WB, Human, HEK 293T cells.
-
Identification and expression of an autosomal paralogue of ribosomal protein S4, X-linked, in mice: Potential involvement of testis-specific ribosomal proteins in translation and spermatogenesis.
Sugihara Y, Sadohara E, Yonezawa K, Kugo M, Oshima K, Matsuda T, Nadano D.
Gene 2013 May; 521(1):91.
Application：WB-Ti, Mouse, Testis.
-
siRNA Knockdown of Ribosomal Protein Gene RPL19 Abrogates the Aggressive Phenotype of Human Prostate Cancer.
Bee A, Brewer D, Beesley C, Dodson A, Forootan S, Dickinson T, Gerard P, Lane B, Yao S, Cooper CS, Djamgoz MB, Gosden CM, Ke Y, Foster CS.
PLoS One 2011 Jul; 6(7):e22672.
Application：WB-Tr, Human, PC-3 cells.
-
A conserved SET-domain methyltransferase, Set11, modifies ribosomal protein Rpl12 in fission yeast.
Sadaie M, Shinmyozu K, Nakayama JI.
The Journal of Biological Chemistry 2008 Jan; 283(11):7185.
Application：WB, Yeast, Schizosaccharomyces pombe.
-
Disruption of valosin-containing protein activity causes cardiomyopathy and reveals pleiotropic functions in cardiac homeostasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com