RPL17 monoclonal antibody (M01), clone 3G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RPL17 expression in transfected 293T cell line by RPL17 monoclonal antibody (M01), clone 3G11.
Lane 1: RPL17 transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL17 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL17 on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant RPL17.
Immunogen
RPL17 (AAH00502, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RPL17 expression in transfected 293T cell line by RPL17 monoclonal antibody (M01), clone 3G11.
Lane 1: RPL17 transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL17 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL17 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RPL17
Entrez GeneID
6139GeneBank Accession#
BC000502Protein Accession#
AAH00502Gene Name
RPL17
Gene Alias
FLJ92089, MGC117162, rpL23
Gene Description
ribosomal protein L17
Omim ID
603661Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L22P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL23 because the encoded protein shares amino acid identity with ribosomal protein L23 from Halobacterium marismortui; however, its official symbol is RPL17. Two alternative splice variants have been observed, each encoding the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L17|gene encoding putative NFkB activating protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com