RPL9 monoclonal antibody (M01), clone 2F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPL9.
Immunogen
RPL9 (NP_000652, 93 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQAD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPL9 monoclonal antibody (M01), clone 2F11 Western Blot analysis of RPL9 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPL9 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL9 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL9 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPL9
Entrez GeneID
6133GeneBank Accession#
NM_000661Protein Accession#
NP_000652Gene Name
RPL9
Gene Alias
DKFZp313J1510, FLJ27456, MGC15545, NPC-A-16
Gene Description
ribosomal protein L9
Omim ID
603686Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
60S ribosomal protein L9|OTTHUMP00000125205
-
Interactome
-
Pathway
-
Publication Reference
-
Autonomous translational pausing is required for XBP1u mRNA recruitment to the ER via the SRP pathway.
Kanda S, Yanagitani K, Yokota Y, Esaki Y, Kohno K.
Proceedings of the National Academy of Sciences of the United States of America 2016 Oct; 113(40):E5886.
Application:WB-Tr, Human, HEK 293T cells.
-
Proteomic characterization of the human sperm nucleus.
de Mateo S, Castillo J, Estanyol JM, Ballesca JL, Oliva R.
Proteomics 2011 Apr; 11:2714.
Application:IF, Human, Spermatozoa.
-
Autonomous translational pausing is required for XBP1u mRNA recruitment to the ER via the SRP pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com