RPL4 monoclonal antibody (M01), clone 4A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3. Western Blot analysis of RPL4 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3. Western Blot analysis of RPL4 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3 Western Blot analysis of RPL4 expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPL4.
Immunogen
RPL4 (NP_000959, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3. Western Blot analysis of RPL4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3. Western Blot analysis of RPL4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
RPL4 monoclonal antibody (M01), clone 4A3 Western Blot analysis of RPL4 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RPL4
Entrez GeneID
6124GeneBank Accession#
NM_000968Protein Accession#
NP_000959Gene Name
RPL4
Gene Alias
-
Gene Description
ribosomal protein L4
Omim ID
180479Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L4
-
Interactome
-
Pathway
-
Publication Reference
-
Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum.
Zhang C, Kho YS, Wang Z, Chiang YT, Ng GK, Shaw PC, Wang Y, Qi RZ.
PLoS One 2014 Jan; 9(1):e85206.
Application：WB-Ce, WB-Tr, Human, HeLa, HEK 293T cells.
-
Shwachman-Bodian Diamond syndrome is a multi-functional protein implicated in cellular stress responses.
Ball HL, Zhang B, Riches JJ, Gandhi R, Li J, Rommens JM, Myers JS.
Human Molecular Genetics 2009 Oct; 18(19):3684.
Application：WB-Ce, Human, HEK 293 cells.
-
Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com