RPA3 monoclonal antibody (M01), clone 1F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RPA3 monoclonal antibody (M01), clone 1F4 Western Blot analysis of RPA3 expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RPA3 expression in transfected 293T cell line by RPA3 monoclonal antibody (M01), clone 1F4.
Lane 1: RPA3 transfected lysate(13.6 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
RNAi Knockdown (Antibody validated)
Western blot analysis of RPA3 over-expressed 293 cell line, cotransfected with RPA3 Validated Chimera RNAi ( Cat # H00006119-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RPA3 monoclonal antibody (M01), clone 1F4 (Cat # H00006119-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPA3.
Immunogen
RPA3 (AAH05264, 12 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Host
Mouse
Reactivity
Human
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPA3 monoclonal antibody (M01), clone 1F4 Western Blot analysis of RPA3 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RPA3 expression in transfected 293T cell line by RPA3 monoclonal antibody (M01), clone 1F4.
Lane 1: RPA3 transfected lysate(13.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RPA3 over-expressed 293 cell line, cotransfected with RPA3 Validated Chimera RNAi ( Cat # H00006119-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RPA3 monoclonal antibody (M01), clone 1F4 (Cat # H00006119-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RPA3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Replication Protein A (RPA1, RPA2 and RPA3) expression in gastric cancer: correlation with clinicopathologic parameters and patients' survival.
Efi Fourtziala, Nick Givalos, Nikolaos Alexakis, John Griniatsos, Nektarios Alevizopoulos, Nikolaos Kavantzas, Andreas C Lazaris, Penelope Korkolopoulou, Hariklia Gakiopoulou.
Journal of B.U.ON.: Official Journal of the Balkan Union of Oncology 2020 May; 25(3):1482.
Application：IHC-P, Human, Human gastric carcinoma.
-
Replication Protein A (RPA1, RPA2 and RPA3) expression in gastric cancer: correlation with clinicopathologic parameters and patients' survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com