RP2 monoclonal antibody (M02), clone 5C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RP2.
Immunogen
RP2 (NP_008846, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RP2 monoclonal antibody (M02), clone 5C10 Western Blot analysis of RP2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of RP2 expression in transfected 293T cell line by RP2 monoclonal antibody (M02), clone 5C10.
Lane 1: RP2 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RP2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RP2
Entrez GeneID
6102GeneBank Accession#
NM_006915Protein Accession#
NP_008846Gene Name
RP2
Gene Alias
DELXp11.3, KIAA0215, TBCCD2
Gene Description
retinitis pigmentosa 2 (X-linked recessive)
Gene Ontology
HyperlinkGene Summary
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death [provided by RefSeq
Other Designations
OTTHUMP00000023189|XRP2 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com