Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RORB polyclonal antibody (A01)

  • Catalog # : H00006096-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RORB.
  • Immunogen:
  • RORB (NP_008845, 136 a.a. ~ 224 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006096-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6096
  • Gene Name:
  • RORB
  • Gene Alias:
  • NR1F2,ROR-BETA,RZR-BETA,RZRB,bA133M9.1
  • Gene Description:
  • RAR-related orphan receptor B
  • Gene Summary:
  • The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021486,RAR-related orphan receptor beta,nuclear receptor RZR-beta,retinoic acid-binding receptor beta,retinoid-related orphan receptor beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook