Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RORA (Human) Recombinant Protein (Q01)

  • Catalog # : H00006095-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RORA partial ORF ( NP_599023, 424 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006095-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6095
  • Gene Name:
  • RORA
  • Gene Alias:
  • DKFZp686M2414,MGC119326,MGC119329,NR1F1,ROR1,ROR2,ROR3,RZR-ALPHA,RZRA
  • Gene Description:
  • RAR-related orphan receptor A
  • Gene Summary:
  • The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • RAR-related orphan receptor alpha,ROR-alpha,retinoic acid receptor-related orphan receptor alpha,retinoid-related orphan receptor alpha,transcription factor RZR-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook