ROCK1 monoclonal antibody (M01), clone 2E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ROCK1.
Immunogen
ROCK1 (NP_005397, 401 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ROCK1 monoclonal antibody (M01), clone 2E2 Western Blot analysis of ROCK1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ROCK1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ROCK1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ROCK1
Entrez GeneID
6093GeneBank Accession#
NM_005406Protein Accession#
NP_005397Gene Name
ROCK1
Gene Alias
MGC131603, MGC43611, P160ROCK, PRO0435
Gene Description
Rho-associated, coiled-coil containing protein kinase 1
Omim ID
601702Gene Ontology
HyperlinkGene Summary
This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. [provided by RefSeq
Other Designations
OTTHUMP00000162514|p160-ROCK
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A novel role of Rho-kinase in the regulation of ligand-induced phosphorylated EGFR endocytosis via the early/late endocytic pathway in human fibrosarcoma cells.
Nishimura Y, Bereczky B, Yoshioka K, Taniguchi S, Itoh K.
Journal of Molecular Histology 2011 Oct; 42(5):427.
Application:IF, Human, HT-1080 cells.
-
Integration of virtual screening with high-throughput screening for the identification of novel Rho-kinase I inhibitors.
Gong LL, Fang LH, Peng JH, Liu AL, Du GH.
Journal of Biotechnology 2009 Dec; 145(3):295.
Application:WB-Re, Recombinant protein.
-
A novel role of Rho-kinase in the regulation of ligand-induced phosphorylated EGFR endocytosis via the early/late endocytic pathway in human fibrosarcoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com