Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNH1 polyclonal antibody (A01)

  • Catalog # : H00006050-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RNH1.
  • Immunogen:
  • RNH1 (NP_976323, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006050-A01
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RNH1 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of RNH1 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6050
  • Gene Name:
  • RNH1
  • Gene Alias:
  • MGC18200,MGC4569,MGC54054,RAI,RNH
  • Gene Description:
  • ribonuclease/angiogenin inhibitor 1
  • Other Designations:
  • OTTHUMP00000147628,Placental ribonuclease inhibitor,ribonuclease/angiogenin inhibitor
  • RSS
  • YouTube
  • Linkedin
  • Facebook