RNF4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RNF4.
Immunogen
RNF4 (NP_002929, 107 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Sequence
YVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.35 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RNF4
Entrez GeneID
6047GeneBank Accession#
NM_002938Protein Accession#
NP_002929Gene Name
RNF4
Gene Alias
RES4-26, SNURF
Gene Description
ring finger protein 4
Omim ID
602850Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. [provided by RefSeq
Other Designations
small nuclear RING finger protein
-
Interactome
-
Disease
-
Publication Reference
-
Targeting TRAF6 E3 ligase activity with a small molecule inhibitor combats autoimmunity.
Brenke JK, Popowicz GM, Schorpp K, Rothenaigner I, Roesner M, Meininger I, Kalinski C, Ringelstetter L, R'kyek O, Jürjens G, Vincendeau M, Plettenburg O, Sattler M, Krappmann D, Hadian K.
The Journal of Biological Chemistry 2018 Aug; 293(34):13191.
Application:WB-Re, Recombinant protein.
-
E1B-55K mediated regulation of RNF4 STUbL promotes HAdV gene expression.
Müncheberg S, Hay RT, Ip WH, Meyer T, Weiß C, Brenke J, Masser S, Hadian K, Dobner T, Schreiner S.
Journal of Virology 2018 Jun; 92(13):e00164.
Application:IP, WB, Human, H1299-H5pg4100, H1299-pE1B-55K-WT, H1299-mock cells.
-
Targeting TRAF6 E3 ligase activity with a small molecule inhibitor combats autoimmunity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com