Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNF4 polyclonal antibody (A01)

  • Catalog # : H00006047-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RNF4.
  • Immunogen:
  • RNF4 (NP_002929, 107 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006047-A01
    Western Blot detection against Immunogen (35.35 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6047
  • Gene Name:
  • RNF4
  • Gene Alias:
  • RES4-26,SNURF
  • Gene Description:
  • ring finger protein 4
  • Gene Summary:
  • The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. [provided by RefSeq
  • Other Designations:
  • small nuclear RING finger protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook