RNF2 monoclonal antibody (M03), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in human stomach.
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in PC-12(Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M03), clone 3G6.
Lane 1: RNF2 transfected lysate (Predicted MW: 36.52 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF2 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RNF2 on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF2.
Immunogen
RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in human stomach.Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
RNF2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of RNF2 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M03), clone 3G6.
Lane 1: RNF2 transfected lysate (Predicted MW: 36.52 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RNF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RNF2
Entrez GeneID
6045GeneBank Accession#
NM_007212Protein Accession#
NP_009143Gene Name
RNF2
Gene Alias
BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Gene Description
ring finger protein 2
Omim ID
608985Gene Ontology
HyperlinkGene Summary
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq
Other Designations
OTTHUMP00000033405|OTTHUMP00000060668
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com