RNF2 monoclonal antibody (M01), clone 6C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of RNF2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of RNF2 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2.
Lane 1: RNF2 transfected lysate(37.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF2 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi ( Cat # H00006045-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody (M01), clone 6C2 (Cat # H00006045-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF2.
Immunogen
RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNF2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of RNF2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RNF2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of RNF2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2.
Lane 1: RNF2 transfected lysate(37.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi ( Cat # H00006045-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody (M01), clone 6C2 (Cat # H00006045-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RNF2
Entrez GeneID
6045GeneBank Accession#
NM_007212Protein Accession#
NP_009143Gene Name
RNF2
Gene Alias
BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Gene Description
ring finger protein 2
Omim ID
608985Gene Ontology
HyperlinkGene Summary
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq
Other Designations
OTTHUMP00000033405|OTTHUMP00000060668
-
Interactome
-
Disease
-
Publication Reference
-
Scmh1 Has E3 Ubiquitin Ligase Activity for Geminin and Histone H2A and Regulates Geminin Stability Directly or Indirectly via Transcriptional Repression of Hoxa9 and Hoxb4.
Yasunaga S, Ohtsubo M, Ohno Y, Saeki K, Kurogi T, Tanaka-Okamoto M, Ishizaki H, Shirai M, Mihara K, Brock HW, Miyoshi J, Takihara Y.
Molecular and Cellular Biology 2012 Dec; 33(4):644.
Application：IF, Human, U-2 OS cell.
-
Inaugural Article: Distinct histone modifications in stem cell lines and tissue lineages from the early mouse embryo.
Rugg-Gunn PJ, Cox BJ, Ralston A, Rossant J.
Proceedings of the National Academy of Sciences of the United States of America 2010 Jun; 107(24):10783.
Application：WB, Mouse, ES, TS, XEN cells.
-
Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell activity.
Ohtsubo M, Yasunaga S, Ohno Y, Tsumura M, Okada S, Ishikawa N, Shirao K, Kikuchi A, Nishitani H, Kobayashi M, Takihara Y.
PNAS 2008 Jul; 105(30):10396.
Application：WB, Spodoptera frugiperda, Sf9 cells.
-
Scmh1 Has E3 Ubiquitin Ligase Activity for Geminin and Histone H2A and Regulates Geminin Stability Directly or Indirectly via Transcriptional Repression of Hoxa9 and Hoxb4.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com