Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RLN2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00006019-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RLN2 protein.
  • Immunogen:
  • RLN2 (ADR83496.1, 1 a.a. ~ 185 a.a) full-length human protein.
  • Sequence:
  • MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 6019
  • Gene Name:
  • RLN2
  • Gene Alias:
  • H2,RLXH2,bA12D24.1.1,bA12D24.1.2
  • Gene Description:
  • relaxin 2
  • Gene Summary:
  • Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. The active form of the encoded protein consists of an A chain and a B chain but their cleavage sites are not definitely described yet. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021027,prorelaxin H2,relaxin H2,relaxin, ovarian, of pregnancy
  • RSS
  • YouTube
  • Linkedin
  • Facebook