RLF monoclonal antibody (M05), clone 2G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RLF.
Immunogen
RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RLF is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — RLF
Entrez GeneID
6018GeneBank Accession#
NM_012421Protein Accession#
NP_036553.1Gene Name
RLF
Gene Alias
MGC142226, ZN-15L, ZNF292L
Gene Description
rearranged L-myc fusion
Omim ID
180610Gene Ontology
HyperlinkOther Designations
OTTHUMP00000006395|Zn-15 related|rearranged L-myc fusion sequence
-
Interactome
-
Publication Reference
-
Loss of Rearranged L-Myc Fusion (RLF) results in defects in heart development in the mouse.
Bourke LM, Del Monte-Nieto G, Outhwaite JE, Bharti V, Pollock PM, Simmons DG, Adam A, Hur SS, Maghzal GJ, Whitelaw E, Stocker R, Suter CM, Harvey RP, Harten SK.
Differentiation 2016 Dec; 94:8.
Application:WB-Ti, Mouse, Mouse brain, embryo, heart, liver, kidney.
-
An ENU mutagenesis screen identifies novel and known genes involved in epigenetic processes in the mouse.
Daxinger L, Harten SK, Oey H, Epp T, Isbel L, Huang E, Whitelaw N, Apedaile A, Sorolla A, Yong J, Bharti V, Sutton J, Ashe A, Pang Z, Wallace N, Gerhardt DJ, Blewitt ME, Jeddeloh JA, Whitelaw E.
Genome Biology 2013 Sep; 14(9):R96.
Application:WB-Ti, Mouse, Embryo.
-
Loss of Rearranged L-Myc Fusion (RLF) results in defects in heart development in the mouse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com