RLN1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RLN1 full-length ORF ( AAH05956.1, 27 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
WKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.12
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RLN1
Entrez GeneID
6013GeneBank Accession#
BC005956Protein Accession#
AAH05956.1Gene Name
RLN1
Gene Alias
H1, RLXH1, bA12D24.3.1, bA12D24.3.2
Gene Description
relaxin 1
Omim ID
179730Gene Ontology
HyperlinkGene Summary
Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. This encoded protein is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds; however, their exact cleavage sites have not been described. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. This gene has multiple polyadenylation sites. There are multiple alternatively spliced transcript variants described for this gene but their full length nature is not known yet. [provided by RefSeq
Other Designations
OTTHUMP00000021026|preprorelaxin H1|prorelaxin|relaxin H1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com