RGS13 monoclonal antibody (M06), clone 1B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RGS13.
Immunogen
RGS13 (NP_658912.1, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RGS13 expression in transfected 293T cell line by RGS13 monoclonal antibody (M06), clone 1B3.
Lane 1: RGS13 transfected lysate(19.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RGS13 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — RGS13
Entrez GeneID
6003GeneBank Accession#
NM_144766Protein Accession#
NP_658912.1Gene Name
RGS13
Gene Alias
MGC17173
Gene Description
regulator of G-protein signaling 13
Omim ID
607190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq
Other Designations
OTTHUMP00000033593|regulator of G-protein signalling 13
-
Interactome
-
Disease
-
Publication Reference
-
Clinicopathological characteristics and genomic profile of primary sinonasal tract diffuse large B-cell lymphoma (DLBCL) reveals gain at 1q31 and RGS1 encoding protein; high RGS1 immunohistochemical expression associates with poor overall survival in DLBCL NOS.
Carreras J, Kikuti YY, Beà S, Miyaoka M, Hiraiwa S, Ikoma H, Nagao R, Martin-Garcia D, Salaverria I, Sato A, Akifumi I, Roncador G, Garcia JF, Ando K, Campo E, Nakamura N.
Histopathology 2016 Oct; [Epub].
Application:IHC, Human, Diffuse large B-cell lymphoma.
-
Clinicopathological characteristics and genomic profile of primary sinonasal tract diffuse large B-cell lymphoma (DLBCL) reveals gain at 1q31 and RGS1 encoding protein; high RGS1 immunohistochemical expression associates with poor overall survival in DLBCL NOS.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com