RGS13 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RGS13 protein.
Immunogen
RGS13 (NP_002918.1, 1 a.a. ~ 159 a.a) full-length human protein.
Sequence
MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RGS13 expression in transfected 293T cell line (H00006003-T01) by RGS13 MaxPab polyclonal antibody.
Lane 1: RGS13 transfected lysate(17.49 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RGS13 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RGS13 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RGS13
Entrez GeneID
6003GeneBank Accession#
NM_002927.3Protein Accession#
NP_002918.1Gene Name
RGS13
Gene Alias
MGC17173
Gene Description
regulator of G-protein signaling 13
Omim ID
607190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq
Other Designations
OTTHUMP00000033593|regulator of G-protein signalling 13
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com