Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RGS12 polyclonal antibody (A01)

  • Catalog # : H00006002-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RGS12.
  • Immunogen:
  • RGS12 (NP_002917, 1095 a.a. ~ 1191 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DGQRVVLEEKDPSRGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006002-A01
    Western Blot detection against Immunogen (36.78 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6002
  • Gene Name:
  • RGS12
  • Gene Alias:
  • DKFZp761K1617,DKFZp761K1817
  • Gene Description:
  • regulator of G-protein signaling 12
  • Gene Summary:
  • This gene encodes a member of the 'regulator of G protein signaling' (RGS) gene family. The encoded protein may function as a guanosine triphosphatase (GTPase)-activating protein as well as a transcriptional repressor. This protein may play a role in tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000115311,OTTHUMP00000115312,regulator of G-protein signalling 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook