RGS10 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RGS10 full-length ORF ( AAH09361, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.65
Interspecies Antigen Sequence
Mouse (92); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RGS10
Entrez GeneID
6001GeneBank Accession#
BC009361Protein Accession#
AAH09361Gene Name
RGS10
Gene Alias
-
Gene Description
regulator of G-protein signaling 10
Omim ID
602856Gene Ontology
HyperlinkGene Summary
Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000020597|OTTHUMP00000069158|regulator of G-protein signalling 10
-
Interactome
-
Disease
-
Publication Reference
-
Characterization of Regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.
Rivero G, Gabilondo AM, Garcia-Sevilla JA, La Harpe R, Morentin B, Meana JJ.
Neurochemistry International 2010 Dec; 57(7):722.
Application:WB-Re, Recombinant protein.
-
Characterization of Regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com