RGS4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RGS4 full-length ORF ( AAH51869, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.29
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RGS4
Entrez GeneID
5999GeneBank Accession#
BC051869Protein Accession#
AAH51869Gene Name
RGS4
Gene Alias
DKFZp761F1924, MGC2124, MGC60244, RGP4, SCZD9
Gene Description
regulator of G-protein signaling 4
Gene Ontology
HyperlinkGene Summary
Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000032322|regulator of G-protein signalling 4|schizophrenia disorder 9
-
Interactome
-
Disease
-
Publication Reference
-
Characterization of Regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.
Rivero G, Gabilondo AM, Garcia-Sevilla JA, La Harpe R, Morentin B, Meana JJ.
Neurochemistry International 2010 Dec; 57(7):722.
Application:WB-Re, Recombinant protein.
-
Characterization of Regulators of G-protein signaling RGS4 and RGS10 proteins in the postmortem human brain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com