Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RFX1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005989-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RFX1 partial ORF ( NP_002909, 502 a.a. - 600 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMTNGVAVGQQPSTGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005989-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5989
  • Gene Name:
  • RFX1
  • Gene Alias:
  • EF-C
  • Gene Description:
  • regulatory factor X, 1 (influences HLA class II expression)
  • Gene Summary:
  • This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. [provided by RefSeq
  • Other Designations:
  • MHC class II regulatory factor RFX,enhancer factor C,regulatory factor X1,trans-acting regulatory factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook