Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RFNG monoclonal antibody (M08), clone 6C7

  • Catalog # : H00005986-M08
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RFNG.
  • Immunogen:
  • RFNG (AAC51359.1, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005986-M08
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RFNG monoclonal antibody (M08), clone 6C7 Western Blot analysis of RFNG expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5986
  • Gene Name:
  • RFNG
  • Gene Alias:
  • -
  • Gene Description:
  • RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • Other Designations:
  • beta-1,3-N-acetylglucosaminyltransferase radical fringe,radical fringe homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook